gluthurk

Information about gluthurk

Published on October 4, 2007

Author: Laurence

Source: authorstream.com

Content

Detection of Cereal Proteins and DNA Using MS, ELISA, and PCR:  Detection of Cereal Proteins and DNA Using MS, ELISA, and PCR William J. Hurkman, Ph. D. USDA/ARS Western Regional Research Center Albany, CA Slide2:  Wheat Flour Proteins Slide3:  Gliadins and Glutenins Are Prolamins Barley, rye, and oat have proteins that are similar to wheat gliadins. Slide4:  Mass Spectrometry (MS) Monoclonal Antibodies (ELISA) Polymerase Chain Reaction (PCR) Several analytical tools are currently available to detect the presence of cereal prolamins in food products: Detection Methods Slide5:  Endosperm proteins Spot Matching, Quantification, Profiling 2-DE Gel Spots Wheat Endosperm Protein Database O-MALDI MS: Peptide mass mapping Tandem MS: Peptide sequencing Digest Pro Tryptic fragments MS Protein Identification Sciex QSTAR Data Wheat Grain Slide6:  Wheat Endosperm Proteins Peroxidase SERPIN GAPDH Slide7:  Many proteins can be separated simultaneously. Protein identification is relatively rapid. Proteins can be quantified. Proteins useful for antibody production. Limited to most abundant proteins. Technically demanding. Equipment is expensive. Pros Cons MS Protein Identification ELISA:  ELISA Takes advantage of the ability of antibodies to recognize and bind to proteins (antigens). More rapid and less expensive than mass spectrometry. Highly specific through use of monoclonal antibodies. (Enzyme-Linked ImmunoSorbant Assay) Slide9:  Monoclonal Antibody Production Slide10:  Sandwich ELISA Sample & Stds Conjugate Substrate Inc. Inc. Inc. Wash Wash Stopping Reagent + - or Slide11:  Detects: Wheat gliadins Barley hordeins Rye secalins But not in oat avenins. R5 Monoclonal Antibody Méndez et al. Eur. J. Gastroenterol. (2003) 15:465. Slide12:  MKTFLIFVLLAMAMKIATAARELNPSNKELQSPQQSFSYQQQPFPQQPYPQQPYPSQQPYPSQQPFPTPQQQFPEQSQQPFTQPQQPTPIQPQQPFPQQPQQPQQPFPQPQQPFPWQPQQPFPQTQQSFPLQPQQPFPQQPQQPFPQPQLPFPQQSEQIIPQQLQQPFPLQPQQPFPQQPQQPFPQPQQPIPVQPQQSFPQQSQQSQQPFAQPQQLFPELQQPIPQQPQQPFPLQPQQPFPQQPQQPFPQQPQQSFPQQPQQPYPQQQPYGSSLTSIGGQ R5 Monoclonal Antibody Recognizes QQPFP Repetitive sequence in gliadins, hordeins, and secalins, but not in avenins. glutamine-glutamine-proline-phenylalanine-proline R5 ELISA Pros:  R5 ELISA Pros Detects wheat, barley, and rye prolamins. Works well for a variety of unprocessed and heat-processed foods. Relatively rapid (1 h 30 min). Sensitive (1.5 ppm). Available in commercial kits. Tested in 20 laboratories (results soon to be published). Temporarily endorsed by the Committee on Methods of Analysis and Sampling of the Codex Alimentarius Commission (more data needed). R5 ELISA Cons:  R5 ELISA Cons Does not distinguish between wheat, barley, and rye. Detects only gliadins in wheat. Celiac patients also react to high and low molecular weight glutenins. Some ingredients have glutenins, but not gliadins. Slide15:  PCR (Polymerase Chain Reaction) Amplification Denature Template DNA Anneal Primers (Forward & Reverse Oligonucleotides) Extend DNA (DNA polymerase, DNTPs) Slide16:  PCR Primers for Prolamins Sandberg et al. Eur. Food Res. Technol. (2003) 217: 344-349. Slide17:  PCR Primers for Prolamins Sandberg et al. Eur. Food Res. Technol. (2003) 217: 344-349. Slide18:  PCR Specificity Primer Pairs Species Wheat Rye Barley Oat Sandberg et al. Eur. Food Res. Technol. (2003) 217: 344-349. PCR:  PCR Species specific: distinguishes between wheat, rye, barley, and oats. Sensitive and rapid. Compliments ELISA results. Detects DNA rather than actual protein. Pros Cons Summary :  Summary Mass spectrometry Excellent tool for protein identification. Sensitive, but not rapid. Expensive and technically demanding. ELISA Works well for a variety of unprocessed and heat-processed foods. Sensitive and rapid. PCR Species specific. Compliments ELISA. Sensitive and rapid.

Related presentations


Other presentations created by Laurence

Growing Grapes in Wisconsin05
04. 01. 2008
0 views

Growing Grapes in Wisconsin05

lec29w
06. 03. 2008
0 views

lec29w

Positive Side of Life
03. 10. 2007
0 views

Positive Side of Life

022Neo Dada
03. 10. 2007
0 views

022Neo Dada

Soil Fertility 101 Wheat focus
09. 10. 2007
0 views

Soil Fertility 101 Wheat focus

confined space training
07. 11. 2007
0 views

confined space training

Vogelsang
13. 11. 2007
0 views

Vogelsang

LR TMSA Danaos conference
15. 11. 2007
0 views

LR TMSA Danaos conference

9 548 Pando UTB 01
19. 11. 2007
0 views

9 548 Pando UTB 01

HPSS IU slides
21. 11. 2007
0 views

HPSS IU slides

ri aquaculture permit process
28. 12. 2007
0 views

ri aquaculture permit process

Ch8
01. 01. 2008
0 views

Ch8

EEP101 15
03. 01. 2008
0 views

EEP101 15

AliyaKassamRE
04. 01. 2008
0 views

AliyaKassamRE

Shiva Kumar Sharma
06. 12. 2007
0 views

Shiva Kumar Sharma

Rabies 1
16. 11. 2007
0 views

Rabies 1

USDA Cultivar Poster
23. 11. 2007
0 views

USDA Cultivar Poster

Bio1100Ch3W
03. 01. 2008
0 views

Bio1100Ch3W

FinalMCX
19. 02. 2008
0 views

FinalMCX

20070412100800
12. 03. 2008
0 views

20070412100800

fasolSlides
14. 03. 2008
0 views

fasolSlides

q3ex
18. 03. 2008
0 views

q3ex

1129130239620
21. 03. 2008
0 views

1129130239620

chonSlides
27. 03. 2008
0 views

chonSlides

penrosepresentation
07. 04. 2008
0 views

penrosepresentation

refupdate
30. 03. 2008
0 views

refupdate

ogan
26. 11. 2007
0 views

ogan

GiraFlyer
23. 11. 2007
0 views

GiraFlyer

netinfo070919
28. 11. 2007
0 views

netinfo070919

Quiz Powerpoint3
06. 11. 2007
0 views

Quiz Powerpoint3

MuseumInformatics
02. 10. 2007
0 views

MuseumInformatics